PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.7E64B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 753aa    MW: 86354.6 Da    PI: 9.5536
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.7E64BgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.26.1e-1328118198
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  ffk+ ++++   ++ l +p+kf +++g+    +  + l+  +  +W++    ++k+g+++++kGWkeF+    L+ g  + F+++g+s+    v++f+
  Araip.7E64B  28 FFKIVLTKSLQ-HKTLKVPNKFSKKYGNG--FPNPVYLKPADDTEWKIDW--TNKDGEILFEKGWKEFAAYYSLENGHLLWFEYNGTSKI--EVQIFD 118
                  66777665555.556***********866..4556***************..********************************986555..888887 PP

2B340.93.7e-13356444598
                  -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                   ++++ l+++r ++p +f++++ +kk e+   ++   +++ W vkl    ++   ++++GW  F+ +n+Lk+gD+++++l++ +++ l  +++r
  Araip.7E64B 356 KITESDLSKSRASVPVSFFNKYFEKK-EP--YVVIRFDSKLWPVKL--LCYQANAYISRGWLAFALDNNLKAGDVCILELVNGKDALLECRIYR 444
                  45677777778***********6554.44..77888999*******..556666789**********************998777766666665 PP

3B338.91.6e-124585391299
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +++ + +p+kf + +g++ +++  + l+ ++g +W++    ++++g++++++GWkeF+    L++g  + F ++++s f   v++f++
  Araip.7E64B 458 TNNKMKIPRKFSRIYGSSVPNP--VYLKLPDGTQWKIDW--TNHDGEIIFKNGWKEFAAYYSLDQGHLLWFDYKKTSLF--EVHIFDT 539
                  5788********9998887776..9**************..********************************998888..9999987 PP

4B3421.6e-136677461799
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                   +p +f++++  kk+ +++++l++   +    kl y  +s++ ++++GW+ Fv a +Lk+gD++vF+l++++++ l v+++r+
  Araip.7E64B 667 AIPVPFFTKYFAKKKPNIQIKLRN---KLLPAKLLYYPSSSAAYISAGWQAFVGASNLKAGDVCVFELVNEKDRVLDVHIYRA 746
                  69********66666677899888...8888899889********************************99999999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-1826120IPR015300DNA-binding pseudobarrel domain
CDDcd100173.39E-1027118No hitNo description
Gene3DG3DSA:2.40.330.101.0E-1827121IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.99827120IPR003340B3 DNA binding domain
PfamPF023625.4E-1028118IPR003340B3 DNA binding domain
SMARTSM010193.3E-1128120IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.3E-11216318IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-9218318IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.032224319IPR003340B3 DNA binding domain
PROSITE profilePS508638.628280319IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-19345441IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-18346434IPR015300DNA-binding pseudobarrel domain
CDDcd100173.24E-15351444No hitNo description
PROSITE profilePS5086311.589352446IPR003340B3 DNA binding domain
SMARTSM010191.0E-11353446IPR003340B3 DNA binding domain
PfamPF023624.3E-11355445IPR003340B3 DNA binding domain
PROSITE profilePS5086312.633447540IPR003340B3 DNA binding domain
SMARTSM010193.2E-9449540IPR003340B3 DNA binding domain
SuperFamilySSF1019365.89E-17451540IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-16458541IPR015300DNA-binding pseudobarrel domain
PfamPF023621.1E-9458539IPR003340B3 DNA binding domain
CDDcd100177.04E-9460538No hitNo description
SuperFamilySSF1019364.51E-7617662IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-6618663IPR015300DNA-binding pseudobarrel domain
CDDcd100179.53E-8618664No hitNo description
PROSITE profilePS508639.389618676IPR003340B3 DNA binding domain
SMARTSM010193.0E-7658747IPR003340B3 DNA binding domain
SuperFamilySSF1019361.61E-12667746IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-13667746IPR015300DNA-binding pseudobarrel domain
PfamPF023623.7E-11667746IPR003340B3 DNA binding domain
CDDcd100171.03E-12668745No hitNo description
PROSITE profilePS508639.77696747IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MREATTTTSM DSSTFQQNHH SPSTVIRFFK IVLTKSLQHK TLKVPNKFSK KYGNGFPNPV  60
YLKPADDTEW KIDWTNKDGE ILFEKGWKEF AAYYSLENGH LLWFEYNGTS KIEVQIFDMS  120
CLEIEYPSND LINDGNLAGI LNEQPQPKKK AKAAPKPSSP SRSKRVKFTV KTIDVEDSEE  180
DSELDSQSKE TQLKKLPYVD DFYPGTSGFQ ALNEAQKFKS ENPFFIVKAR QSNVSRPTVN  240
FQASFFRKYF EKEQNVQIRF QKILIPAKLR CYPYNSHAII ASGWGLFVRT STLQPGDVTI  300
FELIEREDPV LDVHIYRAQD FQPQVSGIQS QKEAKKSKCP KEFKNSESQN PSFVIKITES  360
DLSKSRASVP VSFFNKYFEK KEPYVVIRFD SKLWPVKLLC YQANAYISRG WLAFALDNNL  420
KAGDVCILEL VNGKDALLEC RIYRADVSLL TMLLFCVTNN KMKIPRKFSR IYGSSVPNPV  480
YLKLPDGTQW KIDWTNHDGE IIFKNGWKEF AAYYSLDQGH LLWFDYKKTS LFEVHIFDTS  540
CLEINYPPND HTDDDCVEIL NKPPSPLRGD LRKRSVAPLS TPSKTKRLRS ATKSRDVERG  600
SQSKDTSLEM PKVKISFEGK LFPAKLRYYR QNSTAFISSG WLQFAQASKL QPGDVTVFEL  660
VDRDDPAIPV PFFTKYFAKK KPNIQIKLRN KLLPAKLLYY PSSSAAYISA GWQAFVGASN  720
LKAGDVCVFE LVNEKDRVLD VHIYRAGRYE SNP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182544.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X1
RefseqXP_016182543.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X1
RefseqXP_016182542.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.11e-18B3 family protein